General Information

  • ID:  hor006463
  • Uniprot ID:  Q6X7V3
  • Protein name:  Insulin-like 3 A chain
  • Gene name:  INSL3
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  More strongly expressed in testis than in ovary.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AAATNPAHYCCLSGCSRQDLLTLCPH
  • Length:  26(107-132)
  • Propeptide:  MSPRPLAWALVLLGAALAVALALGSAPAPGAREKLCGHHFVRALVRVCGGPRWSSEDGRRVAGGDRELLQWLEGRHLHGQVSDGDPMLVLVPQALPQASLHHHHRRAAATNPAHYCCLSGCSRQDLLTLCPH
  • Signal peptide:  MSPRPLAWALVLLGAALAVALALG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2
  • Target Unid:  Q5XM32
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q6X7V3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006463_AF2.pdbhor006463_ESM.pdb

Physical Information

Mass: 319228 Formula: C114H181N35O36S4
Absent amino acids: EFIKMVW Common amino acids: ACL
pI: 7.29 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: 11.92 Boman Index: -2424
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.38
Instability Index: 6080.77 Extinction Coefficient cystines: 1740
Absorbance 280nm: 69.6

Literature

  • PubMed ID:  12890727
  • Title:  Isolation and expression analysis of the canine insulin-like factor 3 gene.